Karşiyaka yali mahallesi̇nde, demi̇rköprü i̇zbanin hemen yaninda satilik dükkandir. özellikler. kullanım amacı. atölye; ayakkabıcı büfe. İzmir satılık ev i̇lanları ve fiyatları - emlakjet. Emlak.jet Php günleri 2013 emlak jet sunumu 1. «jet hızında emlak» oya arı dızman i̇ş geliştirme direktörü çağdaş polat dijital pazarlama ve yazılım ekip lideri okan arı kurucu ve genel müdür.

Bir iki ev ve ofis araştırmam nedeniyle bir arkadaşımızın da bana iletmesi sayesinde fark etmiş olduğum bir proje bu emlak jet. Taraftar tv canlı
İstanbul kartal i̇stanbul jet emlak emlak ilanları. Kocaeli darıca satılık daire ilanları ve satılık daire fiyatları emlakjet'te! aradığınız kocaeli darıca satılık ev ilanları ve satılık ev fiyatlarını 1+1, 2+1, 3+1 satılık daire gibi seçenekler ile filtreleyin ve hayalinizdeki satılık daireyi emlakjet'te hemen bulun. Antalya bölgesinde 177 adet daire 700.000 tl'den başlayan fiyatlarla. daire antalya denize sifir için en iyi teklifleri bulun. çok tercih edilen bir tatil bölgesidir. yatırım yapmayı planlıyorsanız ve / veya alanyada daire. olup, en yakın otobüs durağı ve markete 200 m, denize mesafe 1250 metre, al. Gi̇rne caddesi̇n de yapi kredi̇ yani tadi̇latli satilik 2+1 dai̇re. büyük fotoğraf; video; 3 boyutlu tur. Emlakjet admin. Ankara yenimahalle konumunda hayalindeki satılık konut burada! sahibinden ya da emlak ofisinden dubleks, 2+1, 3+1, ev, konut, daire seçenekleri emlakjet'te. Hayalindeki kiralık ev burada! sahibinden ya da emlak ofisinden dubleks, . (function{var uer=false; var eid='fld_1'; (function{var a=uer, b=; if (ersif (eid) {var e=elementbyid (eid); ek=g[h++]; ) up (k, ! 1, d); a}) .call (this); }); html: not (.zaoyte) .kp-wholepage a{outline: 0} rhs kde{border: 0; padding-left: 0; padding-right: 0}.s6jm6d.liykde{width: 654px}yr{box-shadow: none; line-height: 1.58}.i6txqe{background: fff; border-radius: 8px; padding: 0 0 16px 0}.s6jm6d.i6txqe{padding: 0}.tqc1id.i6txqe{border: 1px solid dfe1e5} rhs.hsryr{margin: 6px 0 0 1px}.ky4hfd{display: none}.hsryr.kot7x{margin: 0}.l3cusd{clear: both}.kp-header.zr758c{border-top-right-radius: 0! important}.kp-hc{margin-bottom: 0; padding-top: 12px; padding-bottom: 12px; position: relative; display: inline-block; width: 100%}.s6jm6d.hsryr.kp-hc{padding-bottom: 0}.d7scq{border-bottom: 1px solid ebebeb; border-top: 1px solid ebebeb; border-top-left-radius: 0; border-top-right-radius: 0; font-size: 14px}.hsryr.d7scq{border-top: 0}.wdyxhc{clear: both}.cunqke.wdyxhc, .related-question-pair.wdyxhc, .m8ogie.fm06if.wdyxhc{clear: none}html.kp-blk.xpdclose.lkpcqc, html.kp-blk.xpdopen.vioshc{padding-top: 0}.xpdclose.ohglmf, .xpdopen.xzpb7d{padding-bottom: 16px}.xpdclose.kp-header.ohglmf, .xpdopen.kp-header.xzpb7d{padding-bottom: 0}.c2xztb.xpdclose.ohglmf, .c2xztb.xpdopen.xzpb7d{padding-bottom: 0}.hsryr.xpdclose.ohglmf, .hsryr.xpdopen.xzpb7d{padding-bottom: 0}.wnoohf.xpdclose wvb, .wnoohf.xpdopen vh{padding-bottom: 0} rhs.kp-blk.xpdclose.lkpcqc, rhs.kp-blk.xpdopen.vioshc{padding-top: 0} rhs.wnoohf.xpdopen.yp1cpe, rhs.ojxvsb.xpdclose.sixlze{padding-bottom: 15px} rhs.wnoohf.xpdclose wvb, rhs.wnoohf.xpdopen vh{padding-bottom: 0} rhs.wnoohf.xpdclose ggb, rhs.wnoohf.xpdopen ggb, rhs.kp-blk.ecrggb{padding-bottom: 15px}.c2xztb.kno-mrg, .rutcid.kno-mrg{margin-bottom: 24px; padding: 0}.kno-mrg{position: relative; overflow: hidden} rhs.kno-mrg{border-top-right-radius: 8px} rhs.kno-mrg: not (.kno-mrg-si) {border-top-left-radius: 8px}.kno-mrg.wdyxhc{display: inline}.luibli{float: left; margin-right: 1px}.luibr{float: right; margin-left: -100%}.luibbri{margin-top: 1px}.luib.thumb{position: relative}.kp-header: first-child.biz8kb.lu-fs{border-top-right-radius: 0}.kp-header: first-child.luibr.lu-fs{border-top-left-radius: 0}.kp-header: first-child.biz8kb.thumb{border-top-left-radius: 8px}.z3dsh{background: rgba (0, 0, 0, .54); bottom: 0; color: fff; font-size: 14px; line-height: 1.58; padding: 5px 10px; position: absolute; right: 0}g-img{display: block; height: 100%}.risbzc{display: block; border: 0}.m4duyb{position: relative}.ba0a6c{overflow: hidden}.fwhgmd{background-color: rgba (0, 0, 0, 0.03); position: absolute; top: 0; bottom: 0; left: 0; right: 0}.lu-fs{border-top-left-radius: 8px; border-top-right-radius: 8px}.kp-header: first-child.kno-liu: not (.kno-fiu) .lu-fs{border-top-left-radius: 0}.kp-header: first-child.kno-fiu: not (.kno-liu) .lu-fs{border-top-right-radius: 0}.hlcki{opacity: 0.6}.tuosue{text-align: left}.unhzxb{border-radius: 2px}.fifwie{margin-left: 4px}.oyqbg{margin-top: 4px}.u60jwe{margin-right: 0px}.tbiej{margin-bottom: 0px}.adgvqc{background-color: rgba (255, 255, 255, 0.87); box-shadow: 0px 1px 2px rgba (0, 0, 0, 0.2); height: 32px; width: 32px; display: block; outline: 0; position: absolute; top: 4px; vertical-align: middle}.x5dmzc{right: 4px}.sagwb{float: right; margin-right: 0px}.sagwb: focus{outline: none}.du330c{border-radius: 50%; height: 44px; visibility: hidden; width: 44px}.ab_button{border-radius: 2px; cursor: default; font-family: arial, sans-serif; font-size: 11px; font-weight: bold; height: 27px; line-height: 27px; margin: 2px 0; min-width: 54px; padding: 0 8px; text-align: center; -webkit-transition: color 0.218s; -webkit-user-select: none; background-color: f5f5f5; background-image: -webkit-linear-gradient (top, f5f5f5, f1f1f1); border: 1px solid dadce0; color: 3c4043}_button{color: 3c4043; text-decoration: none; cursor: default}.ab_button: hover{box-shadow: 0 1px 1px rgba (0, 0, 0, .1); -webkit-transition: all 0.0s; background-color: f8f8f8; background-image: -webkit-linear-gradient (top, f8f8f8, f1f1f1); color: 202224}_button, _button: visited{display: inline-block; color: 3c4043; margin-top: 1px}_button: hover{color: 202224}.ewsjzb{display: block}.b8kd8d{position: absolute}.sakbe{border-radius: 8px; box-shadow: 0 2px 10px 0 rgba (0, 0, 0, 0.2) }.vx3ibb{display: block; height: 100%; vertical-align: middle; width: 100%}.vdgvie{text-align: center}.v5npif{display: block; position: relative}.wgim3c{bottom: 0; left: 0; position: absolute; right: 0; top: 0}.psffp{display: inline-block; position: relative}.fy2z0{animation: qli-container-rotate 1568ms linear infinite} keyframes qli-container-rotate {from{transform: rotate (0) }to{transform: rotate (360deg) }}.jg5apd{height: 100%; opacity: 0; position: absolute; width: 100%}.fy2z0.yiqufc{-webkit-animation: qli-fill-unfill-rotate 5332ms cubic-bezier (0.4, 0.0, 0.2, 1) infinite both, qli-blue-fade-in-out 5332ms cubic-bezier (0.4, 0.0, 0.2, 1) infinite both; animation: qli-fill-unfill-rotate 5332ms cubic-bezier (0.4, 0.0, 0.2, 1) infinite both, qli-blue-fade-in-out 5332ms cubic-bezier (0.4, 0.0, 0.2, 1) infinite both}.fy2z0.e3nvve{-webkit-animation: qli-fill-unfill-rotate 5332ms cubic-bezier (0.4, 0.0, 0.2, 1) infinite both, qli-red-fade-in-out 5332ms cubic-bezier (0.4, 0.0, 0.2, 1) infinite both; animation: qli-fill-unfill-rotate 5332ms cubic-bezier (0.4, 0.0, 0.2, 1) infinite both, qli-red-fade-in-out 5332ms cubic-bezier (0.4, 0.0, 0.2, 1) infinite both}.fy2z0.kpjgnb{-webkit-animation: qli-fill-unfill-rotate 5332ms cubic-bezier (0.4, 0.0, 0.2, 1) infinite both, qli-yellow-fade-in-out 5332ms cubic-bezier (0.4, 0.0, 0.2, 1) infinite both; animation: qli-fill-unfill-rotate 5332ms cubic-bezier (0.4, 0.0, 0.2, 1) infinite both, qli-yellow-fade-in-out 5332ms cubic-bezier (0.4, 0.0, 0.2, 1) infinite both}.fy2z0.ft8sdf{-webkit-animation: qli-fill-unfill-rotate 5332ms cubic-bezier (0.4, 0.0, 0.2, 1) infinite both, qli-green-fade-in-out 5332ms cubic-bezier (0.4, 0.0, 0.2, 1) infinite both; animation: qli-fill-unfill-rotate 5332ms cubic-bezier (0.4, 0.0, 0.2, 1) infinite both, qli-green-fade-in-out 5332ms cubic-bezier (0.4, 0.0, 0.2, 1) infinite both}.omjwoc.fy2z0.jg5apd{-webkit-animation: qli-fill-unfill-rotate 5332ms cubic-bezier (0.4, 0.0, 0.2, 1) infinite both; animation: qli-fill-unfill-rotate 5332ms cubic-bezier (0.4, 0.0, 0.2, 1) infinite both; opacity: 0.99} keyframes qli-fill-unfill-rotate {0%{transform: rotate (0) }12.5%{transform: rotate (135deg) }25%{transform: rotate (270deg) }37.5%{transform: rotate (405deg) }50%{transform: rotate (540deg) }62.5%{transform: rotate (675deg) }75%{transform: rotate (810deg) }87.5%{transform: rotate (945deg) }100%{transform: rotate (1080deg) }} keyframes qli-blue-fade-in-out {0%{opacity: 0.99}25%{opacity: 0.99}26%{opacity: 0}89%{opacity: 0}90%{opacity: 0.99}100%{opacity: 0.99}} keyframes qli-red-fade-in-out {0%{opacity: 0}15%{opacity: 0}25%{opacity: 0.99}50%{opacity: 0.99}51%{opacity: 0}} keyframes qli-yellow-fade-in-out {0%{opacity: 0}40%{opacity: 0}50%{opacity: 0.99}75%{opacity: 0.99}76%{opacity: 0}} keyframes qli-green-fade-in-out {0%{opacity: 0}65%{opacity: 0}75%{opacity: 0.99}90%{opacity: 0.99}100%{opacity: 0}}.r1glsd{display: inline-block; height: 100%; overflow: hidden; position: relative; width: 50%}.yvbkfd{box-sizing: border-box; box-sizing: border-box; height: 100%; left: 45%; overflow: hidden; position: absolute; top: 0; width: 10%}.jwrfpe{border-radius: 50%; border: 3px solid transparent; box-sizing: border-box; box-sizing: border-box}.unquac{width: 200%}.zvzqlb{transform: rotate (129deg) }.tjdqhd{left: -100%; transform: rotate (-129deg) }.m0hfif{left: -450%; width: 1000%}.yiqufc.jwrfpe{border-color: 4285f4}.e3nvve.jwrfpe{border-color: ea4335}.kpjgnb.jwrfpe{border-color: fbbc04}.ft8sdf.jwrfpe{border-color: 34a853}.jg5apd.zvzqlb{border-bottom-color: transparent; border-right-color: transparent}.jg5apd.tjdqhd{border-bottom-color: transparent; border-left-color: transparent}.jg5apd.m0hfif{border-bottom-color: transparent}.gupfe.fy2z0.zvzqlb{animation: qli-left-spin 1333ms cubic-bezier (0.4, 0.0, 0.2, 1) infinite both}.gupfe.fy2z0.tjdqhd{animation: qli-right-spin 1333ms cubic-bezier (0.4, 0.0, 0.2, 1) infinite both}.omjwoc.fy2z0.zvzqlb{animation: qli-left-spin 1333ms cubic-bezier (0.4, 0.0, 0.2, 1) infinite both; border-left-color: fff; border-top-color: fff}.omjwoc.fy2z0.tjdqhd{animation: qli-right-spin 1333ms cubic-bezier (0.4, 0.0, 0.2, 1) infinite both; border-right-color: fff; border-top-color: fff} keyframes qli-left-spin {0%{transform: rotate (130deg) }50%{transform: rotate (-5deg) }100%{transform: rotate (130deg) }} keyframes qli-right-spin {0%{transform: rotate (-130deg) }50%{transform: rotate (5deg) }100%{transform: rotate (-130deg) }}.xnef9b{display: inline-block; height: 16px; line-height: 16px; width: 16px; vertical-align: middle; left: -2px}.keizsc{display: inline}.g3idpc{color: ee675c}.hn2iuc{color: 1a73e8; margin-bottom: 2px}.o5q5y{color: fbc02d}bld{display: inline-block; vertical-align: middle; height: 16px; line-height: 16px; width: 16px; left: -2px}.rhstc4.izns7c{padding-top: 14px}.kno-ecr-pt{color: 202224; line-height: 1.2; margin-bottom: -3px; overflow: hidden; font-family: arial, sans-serif-light, sans-serif; display: inline; font-size: 30px; font-weight: normal; position: relative; transform-origin: left top; transform-origin: left top; word-wrap: break-word}.ftghae{padding-left: 16px; padding-right: 16px; margin-top: 0}.s6jm6d.hsryr.ftghae{padding-left: 0; padding-right: 0}.qrshpb{margin: 0} rhs.ftghae{padding-left: 15px; padding-right: 15px}cdf{margin-bottom: 4px; }.iirjib{position: relative}.rhstc4.o66ene, .rhstc5.o66ene, .rhstc5.clchud{position: absolute; right: 0; top: 0}.izns7c{padding-top: 4px; }.qqg1sd{display: inline-block; margin-right: 10px; margin-top: 2px}.q8u8x{font-family: google sans, arial, sans-serif; font-weight: 400}.ob2kfd{display: inline-block}.kp-wholepage-osrp.ob2kfd{line-height: 20px}.aq14fc{color: 70757a; white-space: nowrap}.z3hnkc{background-image: url (data: image/svg+xml, \00003csvg xmlns=' viewbox='0 0 23.44 19'>\00003cpolygon fill='%23dadce0' points='10, 15.27 16.18, 19 14.54, 11.97 20, 7.24 12.81, 6.63 10, 0 7.19, 6.63 0, 7.24 5.46, 11.97 3.82, 19'/>\00003c/svg>); background-repeat: repeat-x; display: inline-block; overflow: hidden; position: relative}.z3hnkc span{background-image: url (data: image/svg+xml, \00003csvg xmlns=' viewbox='0 0 23.44 19'>\00003cpolygon fill='%23fbbc04' points='10, 15.27 16.18, 19 14.54, 11.97 20, 7.24 12.81, 6.63 10, 0 7.19, 6.63 0, 7.24 5.46, 11.97 3.82, 19'/>\00003c/svg>); background-repeat: repeat-x; display: block}.z3hnkc, .z3hnkc span{background-size: 14px 11.4px; height: 11.4px; width: 68px}.xvesr{cursor: pointer; position: fixed; z-index: 9002}.ynlwjd, .dtcycd{bottom: 0; left: 0; position: fixed; right: 0; top: 0; z-index: 9000}.dtcycd{cursor: pointer}.au64fe{cursor: default; min-height: 10px; min-width: 10px; position: relative; z-index: 9001; vertical-align: middle}32{bottom: 0; left: 0; margin: auto; position: fixed; right: 0; top: 0}.ollmo{background-color: rgba (248, 249, 250, 0.85) }wjd: after, .u98ib.dtcycd: after{content: ''; display: inline-block; height: 100%; vertical-align: middle}.u98ib.au64fe{display: inline-block}.xvesr{height: 24px; opacity: .78; right: 32px; top: 32px; width: 24px; background: url (data: image/png; base64, ivborw0kggoaaaansuheugaaadqaaaazcayaaadyfsttaaaabmjlr0qa/wd/ap+gvaetaaaacxbiwxmaaastaaaleweampwyaaaab3rjtuuh3wsgbgcnk8e1iqaaaqbjrefuan7tmrkshcaqrfkj/hr2rydzexijlnogpouqykcs6acic+acexorickbqmcadkcewgh+68wgwukvdf6f5ymsvnisr+khvls3nksoyu1iuno0iebn17asss32cih1m5zqzrysdjnpbk2dy/5xdcplv9szamd2vblc4lyseugwfmopmgqnufkgpeyluauyj1eafrpr4573/ouevlgro3wypgvqd5hkkdwyy532sim3ele4yzb6xnpch2rnlcp8oarwqejwqiqjvrqlktfilqqmstztlvoocl5ujumqojfvwx+hwkvgy/ekcvi0mbte3jew9+glbddh8bltanspn64ny8hqee0aaaaasuvork5cyii=) no-repeat; background-size: 24px 24px}.ollmo.xvesr{background: url (data: image/png; base64, ivborw0kggoaaaansuheugaaadqaaaazagmaaacle8paaaaabgdbtueaalgpc/xhbqaaaalqtfrfvvvvvvvvvvvvmvqqfqaaaaj0uk5tah+2kagvaaaaqeleqvqou32ssrvdiqhfr0ucwmnmbn8op7hkbdyyzqprfclioclhcsidxc+5vscny5vknsdqnwzvjwsdzn2tbbxabsvcg7h7gwvzohsddmipd66qdazzvnegv6iya1tbuwcyu3jacazkdayyvq8gyt6bqbpaofhgkc/s19jieuuzahattkrwh+lvtrpsje2gdlc7l1priek0ddkialwiqkevpaptrf5zx+r5vzhujtlraaaaaelftksuqmcc) no-repeat; background-size: 24px 24px}.xvesr: hover{opacity: 1}.yhemcb: after{background: center center no-repeat url ('data: image/png; base64, ivborw0kggoaaaansuheugaaaaqaaaaecaaaaacmmsgiaaaacxbiwxmaaastaaaleweampwyaaaagkleqvqi12m4xlq6lgfpawkjwyoq8wpptrcaw24j04brosoaaaaasuvork5cyii='); background-size: 2px 2px; content:; letter-spacing: 1em}1ac{margin-top: 4px}.ib08xb{min-height: 60px}.aopfoc{}.hsryr.aopfoc{overflow: visible}.cljaic{margin-bottom: 44px}.hsryr.cljaic{margin-bottom: 0}pp.lmrcfc, .ivvpp.lmrcfc, cfc{margin-top: 6px}.ivvpp.cljaic: not (.wy0elb), .hwkikb: not (.wy0elb) {background: fff; border: 1px solid dfe1e5; border-radius: 8px; margin-top: 16px}.ivvpp 0elb, 0elb{border-left: 1px solid dadce0; padding-left: 20px; padding-bottom: 20px; width: 336px}.kp-wholepage-osrp.j6mbxc a, .kp-wholepage-osrp.j6mbxc a: active, .kp-wholepage-osrp.j6mbxc a: link, .kp-wholepage-osrp.j6mbxc a: visited{color: 70757a; text-decoration: underline}.udzey{font-size: 14px}-c.b03h3d, .wxlzre.b03h3d{margin-top: 0}.tqc1id.ss6qqb.fagajc.ljtgvd, .tqc1id.i8qq8b.fagajc.ljtgvd{margin-top: 0; margin-bottom: 0}.ivvpp.wy0elb.ptclioszqju__wholepage-card, .ivvpp.ptclioszqju__0elb{width: 336px}tc4.wy0elb.ptclioszqju__wholepage-card, tc4.ptclioszqju__0elb{width: 336px}.ivvpp.ptclioszqju__wholepage-card: not (first-card) .v14nkc{border: none; border-top: 1px solid rgba (0, 0, 0, .12); border-radius: 0}.hsryr.wdyxhc: not (.nfqfxe) {padding-left: 15px; padding-right: 15px}.s6jm6d.hsryr.wdyxhc: not (.nfqfxe) {padding-left: 0; padding-right: 0}.s6jm6d.hsryr.wdyxhc hoc, .s6jm6d.hsryr.wdyxhc.iavdid{margin-left: 0; margin-right: 0}.irh78d{font-weight: bold; white-space: nowrap}.zlooqf{margin-top: 7px}.ivvpp.zlooqf, rhs.ss6qqb.zlooqf{line-height: 1.58}.lrzxr{color: 202224}.w8qarf{font-weight: bolder}.w8qarf.fl{color: 202224! important}.gngvve{color: 70757a}.gdrhkb{padding-left: 16px}.a-h{opacity: 0; position: absolute; display: none}.idu36{text-decoration: none; }.nrfcwb{padding-top: 10px; }.nrfcwb, .ubf8rd{color: 1a0dab; display: inline-block; }.nrfcwb span, .ubf8rd span{cursor: pointer; vertical-align: bottom}.nrfcwb: hover, .ubf8rd: hover{text-decoration: underline}.jjswrd{display: inline-flex; align-items: center}.btp3ac{border-color: 1a0dab transparent; border-style: solid; border-width: 4px 4px 0; display: inline-block; height: 0; margin: 5px 0 5px 3px; vertical-align: top; width: 0}.wgfkxc{margin-top: 3px; border-collapse: collapse}.wgfkxc td{padding: 0; }sib{padding-right: 8px; }.k7ltle{font-weight: bold; color: 202224}.tyadee, .vt5nhd{left: 0; right: 0}.wxrmud{border: none; overflow: hidden; width: 100%; height: 100%; position: fixed; top: 0; left: 0; z-index: 9999}.d2awrb{font-weight: bold}.fhbtdf{color: 70757a; height: 24px; padding-right: 24px; width: 24px; vertical-align: middle}.oiacuc{display: -webkit-box; display: -webkit-flex; display: flex; -webkit-align-items: center; align-items: center}sentinel{}.la9ztc{margin-top: -38px; margin-top: 0}.quxkfb{color: 202224; font-weight: bold; float: left; margin-right: 3px}.kp-wholepage-osrp.hwx75c{margin-left: -8px}.hsryr.hwx75c{margin-left: 0}.hwx75c{border-top: solid 1px dadce0; padding-top: 12px; padding-bottom: 8px; padding-left: 24px; margin-left: -24px; border: none; padding: 0; margin: 0}.sogtld{margin: 16px 0 0}.ss2faf a{text-decoration: none}.qlyazd{margin-top: 24px}.ss2faf a: hover{text-decoration: underline}fxe.qlyazd{margin-left: 16px; margin-right: 16px} rhs fxe.qlyazd{margin-left: 15px; margin-right: 15px}.s6jm6d.hsryr fxe.qlyazd{margin-left: 0; margin-right: 0}.ss2faf{color: 202224; line-height: 1.3; font-size: 20px} rhs.ss2faf{font-size: 18px; line-height: 24px}.ss2faf a{color: 202224}.qlpmed{display: inline-block; vertical-align: middle}.fghgvaxenbt__blg{float: right; margin-top: -16px}.reportabusecomponent{height: 100%; width: 100%; position: absolute; overflow-x: hidden; top: 0px; left: 0px; z-index: 1000}.reportabusecard{height: 100%; width: 100%; background-color: white; position: absolute; top: 0px; left: 100%; box-shadow: 0 1px 4px; -webkit-box-shadow: 0 1px 4px}.reportabusecardheader{background-color: 4374e0; min-height: 25px; font-size: 15px; margin-bottom: 5px; padding: 16px 56px; font-weight: 900}ortabusecardiconbutton{display: inline-block; background-color: transparent; position: absolute; top: 10px; color: white; border: none; outline: none; box-shadow: none; -webkit-box-shadow: none; font-size: 36px; height: 36px; min-width: 36px; width: 36px; line-height: 36px; margin: 0 10px; padding: 15px 15px}ortabusecardiconbutton: focus{color: ccc; background-color: transparent; box-shadow: none; outline: none; border: none}ortabusecardheaderbutton{right: 0px}ortabusecardheaderbutton{left: 0px; font-size: 28px}.reportabusecardoptions.reportabusecardbutton{display: inline-block; margin: 5px auto; background-color: white; min-width: 26px; color: 262626; box-shadow: 0 0px 2px rgba (0, 0, 0, .25); -webkit-box-shadow: 0 0px 2px rgba (0, 0, 0, .25); border: 1px solid d9d9d9; padding: 20px 10px; width: 80%; word-wrap: normal; white-space: normal; height: auto}.reportabusecardoptions.reportabusecardbutton: active{box-shadow: inset 0 1px 0 ddd; -webkit-box-shadow: inset 0 1px 0 ddd; background-color: e5e5e5; border-color: bfbfbf}.reportabusecardoptions.reportabusecardbutton: hover{background-color: f5f5f5; box-shadow: 0 0px 2px rgba (0, 0, 0, .3); -webkit-box-shadow: 0 0px 2px rgba (0, 0, 0, .3); border-color: bfbfbf; cursor: pointer}.reportabusecardheadertext{display: inline-block; text-align: center; width: 100%; color: white; outline: none; padding: 18px 0px}.reportabusecardoptions{text-align: center}.reportabusecardfooterbutton{display: none}.reportabusecardmessage{font-size: 16px; padding: 16px}.reportabusedialogcomponent.reportabusecomponentheader{font-size: 24px}.reportabusecomponentmessage{font-size: 16px; margin-top: 20px; margin-bottom: 20px}.reportabusecomponentcards{position: relative}ortabusedialogcomponent{height: auto; width: auto; position: relative; overflow: hidden}.reportabusedialogcomponent.reportabusecardoptions.reportabusecardbutton{padding: 20px 0px; box-shadow: 1px 1px 5px 0px rgba (0, 0, 0, .35); -webkit-box-shadow: 1px 1px 5px 0px rgba (0, 0, 0, .35); border: none; text-align: center; text-transform: none; width: 99%; margin-left: 1px}.reportabusedialogcomponent.reportabusecardoptions.reportabusecardbutton: active{box-shadow: 1px 1px 5px 0px rgba (0, 0, 0, .4); -webkit-box-shadow: 1px 1px 5px 0px rgba (0, 0, 0, .4); background-color: f0f0f0; border-color: transparent}.reportabusedialogcomponent.reportabusecardoptions.reportabusecardbutton: hover{box-shadow: 1px 1px 5px 0px rgba (0, 0, 0, .37); -webkit-box-shadow: 1px 1px 5px 0px rgba (0, 0, 0, .37); background-color: f5f5f5; border-color: transparent}.reportabusedialogcomponent.reportabusecardoptions{text-align: left}.reportabusedialogcomponent.reportabusecard{height: auto; box-shadow: none; -webkit-box-shadow: none; position: relative; left: 0%; display: block}.reportabusedialogcomponent.reportabusecardheader{background-color: white; padding: 16px 0px}.reportabusedialogcomponent.reportabusecardheadertext{color: black; text-align: left}.reportabusedialogcomponent.reportabusecardheaderbutton{display: none}.reportabusedialogcomponent.reportabusecardfooter.reportabusecardfooterbutton{display: inline-block; color: 4374e0; box-shadow: none; -webkit-box-shadow: none; text-align: left; background-color: transparent; padding: 20px 0px; border: none; text-transform: none; margin-left: 1px; cursor: pointer}.inakse{overflow: hidden; text-overflow: ellipsis; white-space: nowrap}.dmxz8{display: block; overflow: hidden; text-decoration: none; text-overflow: ellipsis; vertical-align: top; white-space: nowrap}.vezivc.zljmec{white-space: normal}.vezivc.inakse{display: block; text-align: center}.g5rmf{color: 202224; font-size: 20px; line-height: 1.3}.vezivc.g5rmf{line-height: 1.3; padding-top: 6px}a: hover.g5rmf{text-decoration: underline}.zljmec{font-size: 12px; line-height: 1.34}.vezivc.zljmec{}.km6xsd{color: 70757a; font-size: 12px; line-height: 1.34}.vezivc.km6xsd{line-height: 1.34; padding-top: 8px}43{padding-top: 12px; display: table; table-layout: fixed; width: 100%}.vezivc.dmxz8{display: table-cell; box-sizing: border-box; box-sizing: border-box; border-right: 1px solid f5f5f5; padding: 0 8px}.povrkd.dmxz8{width: 50%}.dmxz8: last-child{border-right-style: none}.idwf4b{margin: 0 16px}.xezgbc{color: 202224; font-size: 18px; margin: 24px 0 0; }.rkbmnb{margin-top: 4px}.zznqh{float: right; margin-bottom: -3px; margin-top: -4px}.srinvb{color: 3c4043}.ut8dke{margin-left: 8px}.eb9vv{height: 16px; width: 16px; color: bdc1c6}.wx3b8{font-size: 13px; padding: 12px} keyframes g-bubble-show {from{opacity: 0}to{opacity: 1}} keyframes g-bubble-hide {from{opacity: 1}to{opacity: 0}}.da3v2b{display: none}.povykd{cursor: pointer}.c0wcec{clip: rect (1px, 1px, 1px, 1px); height: 1px; overflow: hidden; position: absolute; white-space: nowrap; width: 1px; z-index: -1000}.kyo7ef{float: right; margin: 0 0 0 7px}.rabzke{display: none}.ouu58{background: fff; box-shadow: 0 2px 15px rgba (0, 0, 0, .50); box-sizing: border-box; min-width: 400px; overflow: hidden; padding: 20px 30px; text-align: center; z-index: 100}.ecugtc{background: url (data: image/png; base64, ivborw0kggoaaaansuheugaaagoaaablbamaaabq/w83aaaalvbmvevmaxhmzmzmzmzmzmzmzmyhxrqztnk1tnpzwzaztnk0tnq5yskm4mwdzqv///8frw+haaaac3rstlma/8fvgsjhuf//62xhpa4aaag6surbvhgbyqaucbicq1axsjgg3bieqyakwii2j4y7owxpgv5wlbgwxhtbe3yf0tbe6aen4xwfhlm5s77zvo0pt883/85vz2odrtqiv3grtfzltvzltvxlkargqkmodtxqskhitvwodc+z8/lbrys2qstf9jtnkcnmovkfkpxyyjtogofy3mpmkckxxjmqcwbtrlgejr7ygnpw9lgtoqctjf0+pmfbajumilz7sqxvuapmqa9hkd1vervtxoxsu5bu/sbp9cjkersok7ghvn5d1itr4qcjykpqoppd9mcffjgwobl6ar9ajoih9as33uexu0hypsfabfhk+gculwukkjxeoi1zmx7gf0emttj10ghatfs6e5b1cldsn5vhcpgnv3r9s3avmgag1rvcha0axtq/kxeumabdrazcm5xqa+1jqitljz5nw+azseshawef+gzyz/lgpoczcecgbqk4vg8yeochez8/4xebvtayzhl7nnhedijri7yyci1gqgw8zefswchcztawluz3wdy/fkmxsrzyzpshjyfyewnifz4u5n8p+vyioc9kaujcjiduactc8nkzdt/4b4cl+yzmtcbzaaaaaelftksuqmcc) 50% 0/106px 75px no-repeat; font-size: 16px; margin-bottom: 0.25em; padding-top: 80px}.flwlac{font-size: 13px; line-height: 18px; margin: 0 0 13px 0; padding: 0 0 0 0}.eb3vid{margin-top: 16px; position: relative; top: 8px}.vy4hje{border-radius: 2px; cursor: pointer; font-size: 11px; font-weight: bold; height: 27px; min-width: 54px; position: relative; text-align: center; transition: all 0.218s}.ph3y5e{background-color: 4285f4; border: 1px solid 1a73e8; color: fff; padding: 0 18px}.ptpbrb{background-color: f8f9fa; border: 1px solid dadce0; color: 000; margin-right: 15px; padding: 0 8px}.vy4hje: hover{border: 1px solid 3c4043; text-decoration: none}.vy4hje: active{box-shadow: inset 0 1px 2px rgba (0, 0, 0, .30) }.review-dialog:: -webkit-scrollbar{width: 9px}.review-dialog:: -webkit-scrollbar-track{background: none}.review-dialog:: -webkit-scrollbar-thumb{background-color: dadce0; border: 1px solid dadce0; border-radius: 0; border-right: 0}c-wiz{contain: style}c-wiz>c-data{display: none}sd{contain: none}8z{contain: layout style}.nmm5m{fill: currentcolor; -webkit-flex-shrink: 0; flex-shrink: 0}html[dir=rtl].hhikbc{-webkit-transform: scalex (-1); transform: scalex (-1) }.u1m3kd{border: 0 solid dadce0; display: block}.u1m3kd.g6ealc:: before{content:; display: block; margin-bottom: -1px; padding-bottom: 1px}.u1m3kd.g6ealc:: after{content:; display: block; margin-bottom: -1px; padding-bottom: 1px}.u1m3kd.g6ealc{font-family: roboto, helveticaneue, arial, sans-serif; font-size: 14px; font-weight: 400; line-height: 20px; color: 3c4043}.u1m3kd.w2lmue{font-size: 14px; line-height: 1.58; color: 222}.y0kctc{border-top-width: 1px}.jc1k3c{border-bottom-width: 1px}.u9sbk{-webkit-box-flex: 1; -webkit-flex: 1; flex: 1; overflow: hidden; text-overflow: ellipsis; white-space: nowrap}.pqboe{-webkit-box-align: center; box-align: center; -webkit-align-items: center; align-items: center; display: -webkit-box; display: -webkit-flex; display: flex}.u9sbk.g6ealc{margin: 16px 0}.u9sbk.w2lmue{margin: 24px 0 12px}.u9sbk.g6ealc{color: 202224; font-family: google sans, roboto-medium, helveticaneue-medium, helvetica neue, sans-serif-medium, arial, sans-serif; font-size: 18px; font-weight: 500; letter-spacing: .3px; line-height: 24px; text-transform: none}.u9sbk.w2lmue{color: 202224; font-family: roboto, helveticaneue, arial, sans-serif; font-size: 20px; font-weight: 400; line-height: 26px}.pqboe{-webkit-box-align: center; box-align: center; -webkit-align-items: center; align-items: center; display: -webkit-box; display: -webkit-flex; display: flex}.rrvt0e{margin: -16px -12px; padding: 16px 12px; vertical-align: -14px}.kxlpcb{-webkit-box-align: center; box-align: center; -webkit-align-items: center; align-items: center; display: -webkit-box; display: -webkit-flex; display: flex; font-size: 12px; height: 48px; line-height: 24px; padding: 0 16px; white-space: nowrap}.yqs10d{color: 80868b; vertical-align: -12px}.yqs10d: hover{color: 202224; cursor: pointer}sentinel{}brb{overflow: hidden}.zvvugd{padding-top: 8px; white-space: nowrap}.pfs8ld{align-items: flex-end; display: flex}.vlkrkc{flex: 1}.hkuttf{font-size: 14px}0bb{color: 70757a; text-decoration: none}0bb: hover{text-decoration: underline}.h93uf{cursor: pointer}.kno-vrt-t{overflow: hidden}brb{padding-left: 13px}.k0bpbc: first-child, brb: first-child{padding-left: 0}.hsryr brb: first-child{padding-left: 0}.kno-vrt-t{display: inline-block; position: relative; text-align: left; vertical-align: top; } rhs: not (.ivvpp) .kno-vrt-t{padding-left: 16px} rhs.ss6qqb brb, .ivvpp brb{padding-left: 8px} rhs.ss6qqb brb: first-child, .ivvpp.wy0elb brb: first-child{padding-left: 0}.xlbgcb, .obrln, .c9iyee, .myts8, .aahd0c{}.xlbgcb, .c9iyee{white-space: normal}.xlbgcb{color: 70757a; }.obrln{display: block; white-space: normal; margin: 3px 0 -1px; padding-bottom: 1px; width: 100%; }.kno-vrt-t{line-height: 1.29; white-space: normal}.xlbgcb{font-size: 12px; padding-top: 2px; line-height: normal}.ivvpp.obrln, .ivvpp.xlbgcb{font-size: 14px; line-height: 18px}.ss6qqb.obrln, .ss6qqb.xlbgcb{display: -webkit-box; -webkit-box-orient: vertical; -webkit-line-clamp: 2; word-break: break-word}.kno-vrt-t a{display: block; min-height: 100%; }.xq6p1d{border-radius: 8px; overflow: hidden}.zwrhjd{font-family: arial, sans-serif; font-size: 14px; line-height: 18px}.aphytb{font-family: arial, sans-serif; font-size: 12px; line-height: 16px}.yb4h9{background-color: 1a73e8; color: fff; padding: 18px 60px 18px 12px; position: relative}.c85ro{font-size: 20px}.gtr0ne{padding-top: 10px}.yb4h9.gtr0ne a{color: fff; text-decoration: underline}.yb4h9.job8vb{padding: 20px; position: absolute; right: 0; top: 0}.s6jm6d.hsryr myb{padding-left: 0; padding-right: 0}.s6jm6d.hsryr.fhwvod{padding-left: 16px}myb{color: 70757a; display: flex; flex-wrap: wrap-reverse; font-size: 12px; line-height: 1.34; margin-left: 0; margin-right: 0; padding: 4px 16px 0}.fhwvod{padding-right: 2em}8xnb, .uquugf a{color: inherit; display: block}.uquugf{flex: 1; text-align: right}tamamlayıcı sonuçlar (function{var c4=1261; var c5=1349; var no5=false; var spe=true; var pws=1300; (function{var a=setwidth, b=rhstc4; a>=c4&& (b=no5||a=c4&& (c=no5||afotoğrafları görüntüleyindışını görünemlakjetweb sitesiyol tarifi kaydedildi (0) kaydedildi kaydet. Emlak.jet Null null ilanları ile ilgili aradığınız tüm bilgiler, 'da! uygun fiyat için tıklayın.

Kore aşk filmleri izle emlakjet kocaeli

  1. Pribu Emlak.jet
  2. Belek'teki oteller
  3. Eşcinsel
  4. Ankara polatlı satılık ev - emlakjet. Dara bulmaca
  5. Emlak.jet İlgili Bağlantılar
  6. İstanbul satılık ev i̇lanları ve fiyatları - emlakjet.

Pribu Emlak.jet

İstanbul jet emlak - satılık ve kiralık seçenekleri ile arsa, konut, bina, işyeri, devremülk ve turistik tesis ilanları ’da. Emlakjet kurumsal hizmetler.. kurumsal hizmetlerimiz. i̇şinizi yaparken en büyük destekçiniz emlakjet! birlikte daha çok kazanmak için ihtiyacınız olan. Emlakçı paneline hoşgeldiniz. giriş yap.

Belek'teki oteller

Emlakjet. i̇nsanlık tarihi boyunca toprak, gerek yaşanılacak kara parçası gerek ekim dikim alanı gerekse ülke/devlet sınırları olarak önemli bir yere sahip olmuştur. antik çağlarda toprağın önemi ilk başlarda tam olarak bilinmese de insanoğlunun bilişsel olarak gelişimi toprağı işlemesine ve topraktan yaptığı. Emlak jet kampanya şartları i̇lgili kampanya 1 - 31 ekim tarihleri arasında geçerlidir. emlakjet müşterileri kupon kodunu kullanarak %55 indirim avantajı. Emlak.jet Jet emlak Ticaret ünvanıemlakjet i̇nternet hi̇zmetleri̇ ve gayri̇menkul danişmanliği anoni̇m. - Jet emlak i̇lanları - gayrimenkul ofisi zingat. Emlakjet i̇nternet hizmetleri ve gayrimenkul danışmanlığı a.ş. iş ilanları 'de! i̇nsan kaynakları departmanına iş başvurusu veya staj başvurusu yapmak için hemen tıklayın.Antalya satılık ev - emlakjet. Ev-al emlak emlak ofisi ilanlarını hemen inceleyin! ev-al emlak konya - selçuklu kiralık ve satılık i̇lanları 'da. Jetsat'ın kurumsal özelliği, emlak danışmanlarına hizmet verirken, emlakjet premium üyesi olan emlak danışmanları portföylerinde yer alan. Whois lookup for. domain name: registry domain id: 230959542_domain_com-vrsn registrar whois server: registrar url: updated date: 2022-10-16t: 30z creation date: 2005-10-15t: 13z registrar registration expiration date: 2022-10-15t: 13z registrar:, llc registrar iana id: 146 registrar abuse contact email.You need to enable javascript to run this app. Jetemlak, jet emlak, emlak oto yedek parça elektronik aksesuar parfümeri ve yuzlerce farklı alanda ücretsiz ılan ekleyin yayınlıyalım. Emlak.jet İstediğin evin nereye yakın olacağını sen seç, biz de nokta atışı bulalım.

Eşcinsel

Kurtuluş mh. emlak ofisinden gökkuşağı sitesi satılık daire ilanları ve satılık ev fiyatları burada! 1+1, 2+1, 3+1 evler ve diğer seçenekler ile tüm satılık. Net emlak emlak ofisi ilanlarını hemen inceleyin! net emlak i̇zmir - karşıyaka kiralık ve satılık i̇lanları 'da. - Adana bölgesinde 7.270 adet emlak 375.000 tl'den başlayan fiyatlarla. adana bölgesindeki en iyi emlak tekliflerini bulun. aki̇ gayri̇menkuladananin en çok tercih edilen bölgelerinde yatırımlık daireler; hem doğru bir yatırım yapmak hem de satın almak i̇ster misiniz? merkezi konumda. Kiralık daire kanalboyu malatya. kanalboyu emlaktan 3+1 koca mustafa paşa mah. kiralık daire. 44100, malatya, battalgazi, malatya ili bölgesinde. kanalboyu emlaktan3+1bina yaşı 30120 metrekaredogalgaz kombi2. katgeniş teras mevcut1000 tl depozito. Emlak.jet Türki̇ye, ni̇n, en, yeni̇, emlak, i̇lan, si̇tesi̇, emlak satiyor, veya, emlak ki̇raliyor, si̇tesi̇ni̇, kurduk,, türkiye'nin, emlak sitesi, emlak satıyor.Hayalindeki satılık ev burada! sahibinden ya da emlak ofisinden dubleks, . Kullanıcı giriş ekranı. tdv kurumsal giriş. di̇b kurumsal giriş. google hesabı veya microsoft hesabı ile giriş.

Ankara polatlı satılık ev - emlakjet. Dara bulmaca

İstanbul satılık konut alırken dikkat edilecekleri ve satılık daire almanın size. Yakınında ara. i̇stediğin evin nereye yakın olacağını sen seç, . Emlak.jet Jet-4 mert emlak in i̇zmir, reviews by real people. yelp is a fun and easy way to find, recommend and talk about what’s great and not so great in i̇zmir and beyond. - Hakkımızda - emlakjet. Alanya muratpaşa kepez konyaalti manavgat döşemealti. tüm i̇lçeler.Emlakçı paneline hoşgeldiniz. giriş yap. Firma adı, : emlakjet. adres, : bahçelievler merkez, 34100 bahçelievler/i̇stanbul. mahalle, : bahçelievler merkez. i̇lçe, : bahçelievler. İstanbul jet emlak , турция, стамбул, картал, yavuz selim cad., 6b: фотографии, адрес и ☎️ телефон, часы.Ankara konumunda hayalindeki satılık dükkan & mağaza burada! sahibinden ya da emlak ofisinden büro, dükkan, ofis seçenekleri emlakjet'te. Emlakjet jetsat ile evinizi hiç beklemeden ve güvenle hemen satın. Emlak.jet This is emlakjet | jetsat köpek by jingle space on vimeo, the home for high quality videos and the people who love them.

Hayalindeki sahibinden kiralık ev burada! sahibinden ya da emlak ofisinden. Bahçelievler mh. bahçelievler emlak konut sitesi kiralık daire ilanları ve kiralık ev fiyatları burada! 1+1, 2+1, 3+1 evler ve diğer seçenekler ile tüm.

İstanbul satılık ev i̇lanları ve fiyatları - emlakjet.

Emlakjet 301 moved permanently. 301. moved permanently. the document has been permanently moved. Emlakjet - şikayetvar. Emlaktown. Asia emlak - satılık ve kiralık seçenekleri ile arsa, konut, bina, işyeri, devremülk ve turistik tesis ilanları ’da. - Mi̇ne emlak. İstanbul sahibinden satılık ev - emlakjet. Konya i̇li̇nde bulunan tüm emlak si̇teleri̇ satilik ve ki̇ralik ev arsa dai̇re yazlik ofi̇s dükkan vi̇lla sahi̇bi̇nden i̇lanlarini bu sayfada. Is a turkish web-based portal that operates as a real estate site for property search. the portal enables its users to search and find housing, workplace, land, and resort properties for sale and rent as well as land and housing development properties for construction. Ankara yenimahalle konumunda hayalindeki satılık ev burada! sahibinden ya da emlak ofisinden dubleks, 2+1, 3+1, ev, konut, daire seçenekleri emlakjet'te.

Değerlendirme: 9